PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 415aa    MW: 44380.5 Da    PI: 8.294
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006590genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.93.3e-16230286359
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                  ++kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN++L k+l+ ++  + + 
  Lus10006590 230 DVKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLSDISHRYNQS 286
                  689********************************************9998887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-19228292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.473230285IPR004827Basic-leucine zipper domain
PfamPF001704.4E-14231284IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-11232282No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-12232284No hitNo description
PROSITE patternPS000360235250IPR004827Basic-leucine zipper domain
PfamPF124984.9E-24299408IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MDRVFSVDGM SDQFWSPPSP PPPNHQHHSH LPAPSPPLTV DGSSKMNRSA SEWAFQRFLQ  60
EASSAAASDS ERSDVVHIKN QRGNSSSSSS SSVNAANGAA SAAAPPEIPV DSEEYHAFLK  120
SKLNLACAAV ALSRGSYLKP QDSSGRADSG SQASNTSQVG SNAPSKGGND LSWSISKDSD  180
DPVEIPSLPT ALKRSAVLMK STTSGSSRDQ SEDDENEEEF ATADNTNPAD VKRVRRMLSN  240
RESARRSRRR KQAHLTELET QVSQLRVENS SLLKRLSDIS HRYNQSSVDN RVLKADVETL  300
RTKVKMAEET VKRVTGVSTI FQVSSDTSAD AAVPASQHHT HHSPTKPSSN TESRGNNCMS  360
DVSTVENGQS DDGAGGPAVT IGNKIGRKAS LRRIASLEHL QKRIRGGASS NGEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244251RRSRRRKQ
2246251SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038579.11e-145PREDICTED: light-inducible protein CPRF2-like isoform X2
SwissprotQ990901e-111CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLB9SZ771e-140B9SZ77_RICCO; Light-inducible protein CPRF-2, putative
STRINGPOPTR_0013s03800.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41763358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.24e-78bZIP family protein